PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco002548.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 322aa    MW: 35792.1 Da    PI: 5.583
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco002548.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14.1e-102552882255
                  SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                   +yp++e++ +LA+k+gL+ +q+ +WF N+R ++
  Aco002548.1 255 WPYPTEEDKVKLAEKTGLDPKQINNWFINQRKRH 288
                  58*****************************885 PP

2ELK35.52.1e-12208229122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK++Ll+KYsgyL+sL++EF+
  Aco002548.1 208 ELKEMLLKKYSGYLSSLRKEFL 229
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.0E-215195IPR005540KNOX1
PfamPF037905.3E-205393IPR005540KNOX1
SMARTSM011881.3E-6208229IPR005539ELK domain
PROSITE profilePS5121311.313208228IPR005539ELK domain
PfamPF037899.3E-10208229IPR005539ELK domain
PROSITE profilePS5007112.957228291IPR001356Homeobox domain
SMARTSM003894.8E-14230295IPR001356Homeobox domain
SuperFamilySSF466899.84E-20230299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27233293IPR009057Homeodomain-like
CDDcd000862.53E-13240292No hitNo description
PfamPF059202.5E-17248287IPR008422Homeobox KN domain
PROSITE patternPS000270266289IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MEDLYSIHPG ISRGAGELDG DHHHHRRRRR GVAGDASEIS GGSGGASDLN DMIKAQIASH  60
PRYPSLVSAY IDCRKVGAPL EVATLLEEIG RERSSSAASC DGGEIGADPE LDEFMCEYII  120
EGHFALVIVF SSPLEHDGPL LETSDRTIFE SYSKCLTEAC LHLTRTNLVY LSSDEVVGSS  180
EEELCSADAE PSDGYHEYGS SSRLADHELK EMLLKKYSGY LSSLRKEFLK KRKKGKLPKD  240
ARTTLLDWWN THYRWPYPTE EDKVKLAEKT GLDPKQINNW FINQRKRHWK PSEDMRFALM  300
EGVAGGSSGT MIYFDTGTVG P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1223232LRKEFLKKRK
2229233KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781110.11e-120PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-106KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLF2YNF21e-117F2YNF2_ELAGV; Knotted-like homebox protein
STRINGBRADI2G11540.11e-115(Brachypodium distachyon)
STRINGGSMUA_Achr8P10550_0011e-115(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.14e-54KNOTTED1-like homeobox gene 6